PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400006670
Common NameLOC102594726
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ZF-HD
Protein Properties Length: 285aa    MW: 30974.6 Da    PI: 8.8345
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400006670genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.55.6e-3265120359
           ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                           ++rY+eClkNhAa++Gg+++DGCgEfmps g egt +alkCaAC+CHRnFHR+e+ +
  PGSC0003DMP400006670  65 RARYRECLKNHAANIGGNVTDGCGEFMPS-GGEGTLEALKCAACNCHRNFHRKEQPN 120
                           789*************************9.8899*******************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.7E-2966118IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257745.0E-2167117IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.8E-3067117IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.22368117IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.603.4E-28204271IPR009057Homeodomain-like
SuperFamilySSF466892.41E-16207270IPR009057Homeodomain-like
TIGRFAMsTIGR015652.3E-28213270IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MELAGGEEKE MRMSGYHSLD QNIDLLSPTG GGGGGGGAAP GDGAAPHTNS TAGSNKFNKG  60
TTTARARYRE CLKNHAANIG GNVTDGCGEF MPSGGEGTLE ALKCAACNCH RNFHRKEQPN  120
NNAGIMVVHP LQLPQSLPSP IPSLNHHHHH HHQHGGGRSI WTTMPPQPVK MAFGGSGGGS  180
GATDSSSEEL NFNTYHHQQA TSVHPQQPFM LAKKRFRTKF SQEQKEKMLE FAEKLGWRIP  240
REDDTEVQRF CSQVGVKRQV FKVWMHNNKN PSSAKKNIIQ EDQP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-252142731879ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754431e-168HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006341952.10.0PREDICTED: zinc-finger homeodomain protein 2
SwissprotQ9ZPW75e-60ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLM0ZWJ40.0M0ZWJ4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000095810.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.28e-55homeobox protein 31
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]